PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Solyc06g009010.1.1
Common NameLOC101256092
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family NF-YB
Protein Properties Length: 179aa    MW: 20445.9 Da    PI: 5.3951
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Solyc06g009010.1.1genomeITAGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB174.51.1e-5431126297
               NF-YB   2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyre 92 
                         +eqdr+lPianv+rimk++lP nakisk+aket+qecvsefisfvt+easdkc++ekrkt+ngdd++wal++lGf+dyveplk yl+kyre
  Solyc06g009010.1.1  31 KEQDRLLPIANVGRIMKQILPPNAKISKEAKETMQECVSEFISFVTGEASDKCHNEKRKTLNGDDICWALGSLGFDDYVEPLKRYLHKYRE 121
                         79***************************************************************************************** PP

               NF-YB  93 legek 97 
                         lege+
  Solyc06g009010.1.1 122 LEGER 126
                         **996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.103.1E-5230149IPR009072Histone-fold
SuperFamilySSF471136.52E-4133151IPR009072Histone-fold
PfamPF008082.8E-2736100IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006152.5E-196482No hitNo description
PROSITE patternPS0068506783IPR003956Transcription factor, NFYB/HAP3, conserved site
PRINTSPR006152.5E-1983101No hitNo description
PRINTSPR006152.5E-19102120No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 179 aa     Download sequence    Send to blast
MVDNNINILR SKYDRESSNY NSISEDGLIY KEQDRLLPIA NVGRIMKQIL PPNAKISKEA  60
KETMQECVSE FISFVTGEAS DKCHNEKRKT LNGDDICWAL GSLGFDDYVE PLKRYLHKYR  120
ELEGERINQS KGVGLGNNIE DQRGRDDDEL TQRGSTIPFK ITIMDHKGEN NFLPTRPY*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4g91_B4e-4431121292Transcription factor HapC (Eurofung)
4g92_B4e-4431121292Transcription factor HapC (Eurofung)
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004240535.11e-131PREDICTED: nuclear transcription factor Y subunit B-4-like
SwissprotO822481e-59NFYB5_ARATH; Nuclear transcription factor Y subunit B-5
TrEMBLK4C3T11e-131K4C3T1_SOLLC; Uncharacterized protein
STRINGSolyc06g009010.1.11e-130(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA11124356
Representative plantOGRP16817170
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G47810.16e-61nuclear factor Y, subunit B5
Publications ? help Back to Top
  1. Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD
    Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments.
    Theor. Appl. Genet., 2005. 112(1): p. 72-84
    [PMID:16208505]